Recombinant Human REEP6 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens receptor accessory protein 6 (REEP6), transcript variant 2 (NM_138393).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96HR9
Entry Name REEP6_HUMAN
Gene Names REEP6 C19orf32 DP1L1
Alternative Gene Names C19orf32 DP1L1
Alternative Protein Names Receptor expression-enhancing protein 6 (Polyposis locus protein 1-like 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 211
Molecular Weight(Da) 23418
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVLQVLARSRAGITPVAVAGPSTPLEADLKPSQTPQPKDK
Background
Function FUNCTION: Required for correct function and survival of retinal photoreceptors (PubMed:27889058). Required for retinal development (By similarity). In rod photoreceptors, facilitates stability and/or trafficking of guanylate cyclases and is required to maintain endoplasmic reticulum and mitochondrial homeostasis (By similarity). May play a role in clathrin-coated intracellular vesicle trafficking of proteins from the endoplasmic reticulum to the retinal rod plasma membrane (By similarity). {ECO:0000250|UniProtKB:Q9JM62, ECO:0000269|PubMed:27889058}.
Pathway
Protein Families DP1 family
Tissue Specificity Expressed in circumvallate papillae and testis (PubMed:16720576). Expressed in the retina. Isoform 1 is predominantly present in mature optic cups. Isoform 1 expression is confined to the cell body and inner segment of developing rod photoreceptor cells (PubMed:27889058). {ECO:0000269|PubMed:16720576, ECO:0000269|PubMed:27889058}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8465835

Recombinant Human REEP6 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human REEP6 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.